Structure of PDB 7oya Chain O2

Receptor sequence

>7oyaO2 (length=133) Species: 7955 (Danio rerio) [Search protein sequence]

PQVAEGENVFGVCHIFASFNDTFVHVTDLSGKETICRVTGGMKVKADRDE
SSPYAAMLAAQDVAQKCKELGITALHIKLRATGGNRTKTPGPGAQSALRA
LARSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL

3D structure

PDB

7oya A molecular network of conserved factors keeps ribosomes dormant in the egg.

Chain

Resolution

3.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	O2	H32 F34 N38 D39 F41 H43 G49 K50 E51 T52 R55 T57 G59 M60 D65 R66 E68 G102 R104 I135 P136 S137 D138 R141 K143 G144 G145 R146 R147 R149 R150 L151	H14 F16 N20 D21 F23 H25 G31 K32 E33 T34 R37 T39 G41 M42 D47 R48 E50 G84 R86 I117 P118 S119 D120 R123 K125 G126 G127 R128 R129 R131 R132 L133

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0006412	translation
GO:0043009	chordate embryonic development
GO:0043249	erythrocyte maturation
GO:0048821	erythrocyte development

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links