Structure of PDB 5fci Chain O1

Receptor sequence
>5fciO1 (length=109) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
LKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVRLAP
ELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVASAKG
LQTVVVEED
3D structure
PDB5fci ?
ChainO1
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna O1 R10 T13 H17 K18 R19 H21 G22 F25 K26 R28 V33 K34 F39 H43 L51 P53 N56 Q57 W60 R62 G63 V64 K65 R70 G103 L104 Q105 R7 T10 H14 K15 R16 H18 G19 F22 K23 R25 V30 K31 F36 H40 L48 P50 N53 Q54 W57 R59 G60 V61 K62 R67 G100 L101 Q102
BS02 MG O1 N56 W60 N53 W57
BS03 MG O1 Y12 T13 Y9 T10
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006450 regulation of translational fidelity
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5fci, PDBe:5fci, PDBj:5fci
PDBsum5fci
PubMed26906928
UniProtP0C2H8|RL31A_YEAST Large ribosomal subunit protein eL31A (Gene Name=RPL31A)

[Back to BioLiP]