Structure of PDB 4u4n Chain O1

Receptor sequence
>4u4nO1 (length=109) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
LKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVRLAP
ELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVASAKG
LQTVVVEED
3D structure
PDB4u4n ?
ChainO1
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna O1 R10 T13 N15 H17 K18 H21 S24 F25 K26 R28 V33 K34 F39 H43 L51 P53 N56 W60 R62 G63 V64 K65 Y69 R70 G103 L104 Q105 R7 T10 N12 H14 K15 H18 S21 F22 K23 R25 V30 K31 F36 H40 L48 P50 N53 W57 R59 G60 V61 K62 Y66 R67 G100 L101 Q102
BS02 OHX O1 E82 E83 E79 E80
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006450 regulation of translational fidelity
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4u4n, PDBe:4u4n, PDBj:4u4n
PDBsum4u4n
PubMed25209664
UniProtP0C2H8|RL31A_YEAST Large ribosomal subunit protein eL31A (Gene Name=RPL31A)

[Back to BioLiP]