Structure of PDB 4u3n Chain O1

Receptor sequence
>4u3nO1 (length=109) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
LKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVRLAP
ELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVASAKG
LQTVVVEED
3D structure
PDB4u3n ?
ChainO1
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna O1 R10 T13 N15 H17 K18 R19 H21 F25 K26 R28 V33 K34 F39 H43 L51 P53 N56 W60 R62 V64 K65 Y69 R70 K102 G103 L104 Q105 R7 T10 N12 H14 K15 R16 H18 F22 K23 R25 V30 K31 F36 H40 L48 P50 N53 W57 R59 V61 K62 Y66 R67 K99 G100 L101 Q102
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006450 regulation of translational fidelity
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4u3n, PDBe:4u3n, PDBj:4u3n
PDBsum4u3n
PubMed25209664
UniProtP0C2H8|RL31A_YEAST Large ribosomal subunit protein eL31A (Gene Name=RPL31A)

[Back to BioLiP]