Structure of PDB 4u3m Chain O1

Receptor sequence

>4u3mO1 (length=109) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

LKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVRLAP
ELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVASAKG
LQTVVVEED

3D structure

PDB

4u3m ?

Chain

Resolution

3.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	O1	R10 T13 N15 H17 K18 R19 H21 S24 F25 K26 R28 V33 K34 H43 L51 P53 N56 Q57 W60 R62 G63 V64 K65 Y69 R70 K102 L104 Q105 T106	R7 T10 N12 H14 K15 R16 H18 S21 F22 K23 R25 V30 K31 H40 L48 P50 N53 Q54 W57 R59 G60 V61 K62 Y66 R67 K99 L101 Q102 T103
BS02	OHX	O1	E82 E83	E79 E80

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0006450	regulation of translational fidelity

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4u3m, PDBe:4u3m, PDBj:4u3m
PDBsum	4u3m
PubMed	25209664
UniProt	P0C2H8\|RL31A_YEAST Large ribosomal subunit protein eL31A (Gene Name=RPL31A)