Structure of PDB 9cg5 Chain O

Receptor sequence
>9cg5O (length=88) Species: 562 (Escherichia coli) [Search protein sequence]
SLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHH
SRRGLLRMVSQRRKLLDYLKRKDVARYTQLIERLGLRR
3D structure
PDB9cg5 Structural analysis of noncanonical translation initiation complexes.
ChainO
Resolution2.59 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna O T5 T8 R17 N20 D21 T22 G23 Q28 L31 L39 H42 H46 K48 D49 H50 H51 S52 R54 G55 Q62 Y69 T4 T7 R16 N19 D20 T21 G22 Q27 L30 L38 H41 H45 K47 D48 H49 H50 S51 R53 G54 Q61 Y68
BS02 rna O Q40 L57 V60 R88 Q39 L56 V59 R87
External links