Structure of PDB 8wgh Chain O

Receptor sequence
>8wghO (length=89) Species: 141305 (Fittonia albivenis) [Search protein sequence]
FERDWLRTDLNVIGFGLIGWLAPSSIPAINGNSLTGLFFSSIGPELAHFP
TGPAVTSPFWLWMVLWHLGLFLTLTFGQIGFKGRSEGYF
3D structure
PDB8wgh Cryo-EM structure of the red-shifted Fittonia albivenis PSI-LHCI
ChainO
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA O I84 L120 I29 L65
BS02 CLA O T106 G107 W115 T51 G52 W60
BS03 CLA O T130 I134 K137 T75 I79 K82
BS04 CLA O F93 M118 W121 H122 L125 F126 F38 M63 W66 H67 L70 F71
BS05 CLA O T128 F131 G132 F136 R139 T73 F76 G77 F81 R84
External links