Structure of PDB 8uu9 Chain O

Receptor sequence
>8uu9O (length=134) Species: 1642 (Listeria innocua) [Search protein sequence]
MLVPKRVKYRREFRGNMRGRAKGGTEVAFGEYGLQAVEASWITNRQIEAA
RIAMTRYMKRGGKVWIKIFPHKSYTSKPIGVRMGKGKGAPEGWVSPVKRG
KIMFEIAGVPEDVAREALRLAAHKLPVKTKIVKR
3D structure
PDB8uu9 Mechanistic insights into the alternative ribosome recycling by HflXr.
ChainO
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna O P4 R6 Y9 R11 F13 R14 G15 N16 R18 K22 Q46 K63 W65 F69 H71 K77 G80 R82 M83 G84 K85 G86 K87 H123 K124 P126 P4 R6 Y9 R11 F13 R14 G15 N16 R18 K22 Q46 K63 W65 F69 H71 K77 G80 R82 M83 G84 K85 G86 K87 H123 K124 P126
BS02 rna O N16 M17 G19 R99 N16 M17 G19 R99
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8uu9, PDBe:8uu9, PDBj:8uu9
PDBsum8uu9
PubMed38407413
UniProtA0A0U4VSU8

[Back to BioLiP]