Structure of PDB 8s1p Chain O

Receptor sequence

>8s1pO (length=120) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

MITKTSKNAARLKRHARVRAKLSGTAERPRLNVFRSNKHIYAQIIDDVNG
VTLASASTLDKDLNVESTGDTSAATKVGELVAKRAAEKGISDVVFDRGGY
LYHGRVKALADAAREAGLKF

3D structure

• PDB: 8s1p A role for the S4-domain containing protein YlmH in ribosome-associated quality control in Bacillus subtilis.
• Chain: O
• Resolution: 1.96 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	O	M1 I2 T3 K13 R14 A16 R17 K21 F95 R97 Y102 R114 F120	M1 I2 T3 K13 R14 A16 R17 K21 F95 R97 Y102 R114 F120
BS02	rna	O	S6 K7 R11 H15 R19 R30 N32 F34 R35 S36 N37 K38 H39 Y41 Q43 G50 V51 T52 S55 S67 D70 T71 L101 H103 G104 R105	S6 K7 R11 H15 R19 R30 N32 F34 R35 S36 N37 K38 H39 Y41 Q43 G50 V51 T52 S55 S67 D70 T71 L101 H103 G104 R105

Gene Ontology

Molecular Function

• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006364 rRNA processing
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8s1p, PDBe:8s1p, PDBj:8s1p
• PDBsum: 8s1p
• PubMed: 38811035
• UniProt: P46899|RL18_BACSU Large ribosomal subunit protein uL18 (Gene Name=rplR)