Structure of PDB 8p2f Chain O

Receptor sequence

>8p2fO (length=145) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]

MKLHELKPAEGSRKERNRVGRGVATGNGKTSGRGHKGQKARSGGGVRPGF
EGGQLPLFRRLPKRGFTNINRKEYAIVNLDQLNKFEDGTEVTPALLVESG
VVKNEKSGIKILGNGSLDKKLTVKAHKFSASAAEAIDAKGGAHEV

3D structure

PDB

8p2f Cryo-EM structures of Staphylococcus aureus 70S ribosomes in complex with elongation factor G and fusidic acid

Chain

Resolution

2.44 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	O	L3 H4 L6 K7 E10 G11 S12 R13 K14 R16 R18 V19 G20 R21 G22 A24 T25 G28 K29 T30 S31 G32 R33 G34 H35 K36 G37 Q38 K39 R41 S42 G43 V46 R47 F50 G52 G53 Q54 L55 R59 R60 L61 P62 K63 R64 G65 F66 N68 N70 R71 K72 I76 N78 K103 K110 L112 G113 N114 S129 A130 S131	L3 H4 L6 K7 E10 G11 S12 R13 K14 R16 R18 V19 G20 R21 G22 A24 T25 G28 K29 T30 S31 G32 R33 G34 H35 K36 G37 Q38 K39 R41 S42 G43 V46 R47 F50 G52 G53 Q54 L55 R59 R60 L61 P62 K63 R64 G65 F66 N68 N70 R71 K72 I76 N78 K103 K110 L112 G113 N114 S129 A130 S131

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8p2f, PDBe:8p2f, PDBj:8p2f
PDBsum	8p2f
PubMed	38902339
UniProt	P0A0F8\|RL15_STAA8 Large ribosomal subunit protein uL15 (Gene Name=rplO)