Structure of PDB 8olt Chain O

Receptor sequence

>8oltO (length=320) Species: 10090 (Mus musculus)

LRYGLLAAILGDKTTKKLHEYSRVITVDGNICSGKNKLAKEIAQQLGMKH
YPEAGIQYSSTTTGDGRPLDIEFSGSCSLEKFYDDPKSNDGNSYRLQSWL
YASRLLQYADALEHLLSTGQGVVLERSIYSDFVFLEAMYNQGYIRKQCVD
HYNEIKRLTLPEYLPPHAVIYIDVPVPEVQSRIQKKGDPHEMKVTSAYLQ
DIENAYKKTFLPKMSEMCEVLVYDSWEAEDPTKVVEDIEYLKYNKGPWLK
QDDWTFHYLRMLVQDKTEVLNYTTIPVYLPEITIGAHQGSRIYNSFRELP
GRKYAPGYNAEVGDKWIWLK

3D structure

• PDB: 8olt Investigation of hydrated channels and proton pathways in a high-resolution cryo-EM structure of mammalian complex I.
• Chain: O
• Resolution: 2.84 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GTP	O	C32 G34 K35 N36 E53 L79 Y83 Q97 L100 R104 R126 F134 K186 E191	C32 G34 K35 N36 E53 L79 Y83 Q97 L100 R104 R126 F134 K186 E191

Gene Ontology

Molecular Function

• GO:0008137 NADH dehydrogenase (ubiquinone) activity

Biological Process

• GO:0006120 mitochondrial electron transport, NADH to ubiquinone
• GO:0009060 aerobic respiration
• GO:0032981 mitochondrial respiratory chain complex I assembly
• GO:0042776 proton motive force-driven mitochondrial ATP synthesis
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005759 mitochondrial matrix
• GO:0043209 myelin sheath
• GO:0045271 respiratory chain complex I

External links

• PDB: RCSB:8olt, PDBe:8olt, PDBj:8olt
• PDBsum: 8olt
• PubMed: 37531432
• UniProt: Q99LC3|NDUAA_MOUSE NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial (Gene Name=Ndufa10)