Structure of PDB 8kd7 Chain O

Receptor sequence
>8kd7O (length=104) Species: 8355 (Xenopus laevis) [Search protein sequence]
ATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLAAIHAKRVTIMPKDIQLARRI
RGER
3D structure
PDB8kd7 Structural basis of nucleosome deacetylation and DNA linker tightening by Rpd3S histone deacetylase complex.
ChainO
Resolution3.09 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna O X36 H39 R40 Y41 P43 G44 V46 R49 R63 K64 L65 P66 R69 R83 X6 H9 R10 Y11 P13 G14 V16 R19 R33 K34 L35 P36 R39 R53
BS02 dna O H39 Y41 R42 R63 R72 R83 F84 Q85 S86 R116 V117 T118 H9 Y11 R12 R33 R42 R53 F54 Q55 S56 R86 V87 T88
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8kd7, PDBe:8kd7, PDBj:8kd7
PDBsum8kd7
PubMed37666978
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]