Structure of PDB 8k5p Chain O

Receptor sequence
>8k5pO (length=346) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
PKEIGFYSRTKDEEYLISDDTNLNYYYLPDAELDRKLDLSSGFQKFKDYY
KDFEDRCSLRGLLETIESSERHKGKKINADIITFRGIARKLISCAFDSPS
FNTVDLRIVSFNGQLFIKEQDLNVFTGYKFETLATLSNPLQYTPREVIEK
RTKRIVSHGDEYISVVRTGVGNCKLILGAEVDCIFDFKENGRDNLKHYAE
LKCTQQVANISDTHKFERKLFRTWLQCFLVGIPRIIYGFKDDHYVLKTVE
EFSTEEVPVLLKNNNPQVGSACLEAIKWYGLLTEWLLKMIPRDEDPHSQI
RAFKLVFENNHLRLSEIEESDEEYSGLIDGEHILSNGFKEWRKSLK
3D structure
PDB8k5p Structural basis of exoribonuclease-mediated mRNA transcription termination
ChainO
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.1.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MG O D223 E241 D182 E200
Gene Ontology
Molecular Function
GO:0000166 nucleotide binding
GO:0003723 RNA binding
GO:0004518 nuclease activity
GO:0005515 protein binding
GO:0030234 enzyme regulator activity
GO:0034353 mRNA 5'-diphosphatase activity
GO:0046872 metal ion binding
GO:0110152 RNA NAD+-cap (NAD+-forming) hydrolase activity
GO:1990174 phosphodiesterase decapping endonuclease activity
Biological Process
GO:0000448 cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000466 maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000956 nuclear-transcribed mRNA catabolic process
GO:0006353 DNA-templated transcription termination
GO:0006364 rRNA processing
GO:0006397 mRNA processing
GO:0030846 termination of RNA polymerase II transcription, poly(A)-coupled
GO:0031087 deadenylation-independent decapping of nuclear-transcribed mRNA
GO:0071035 nuclear polyadenylation-dependent rRNA catabolic process
GO:0110155 NAD-cap decapping
GO:1904595 positive regulation of termination of RNA polymerase II transcription
Cellular Component
GO:0005634 nucleus
GO:0005829 cytosol
GO:0090730 Las1 complex
GO:0110103 RNA polymerase II termination complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8k5p, PDBe:8k5p, PDBj:8k5p
PDBsum8k5p
PubMed38538796
UniProtP53063|DXO_YEAST Decapping nuclease RAI1 (Gene Name=RAI1)

[Back to BioLiP]