Structure of PDB 8j6z Chain O

Receptor sequence
>8j6zO (length=86) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]
ERNWLRRDLNVVGFGLIGWLAPSSIPAINGKSLTGLFFDSIGTELAHFPT
PPALTSQFWLWLVTWHLGLFLCLTFGQIGFKGRTED
3D structure
PDB8j6z Cryo-EM structure of the Arabidopsis thaliana photosystem I(PSI-LHCII-ST2)
ChainO
Resolution2.79 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA O I130 K133 I78 K81
BS02 CLA O F127 G128 G131 F132 F75 G76 G79 F80
BS03 CLA O L114 W117 H118 L121 L62 W65 H66 L69
BS04 CHL O N62 F66 N10 F14
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0005515 protein binding
Biological Process
GO:0009767 photosynthetic electron transport chain
GO:0009768 photosynthesis, light harvesting in photosystem I
GO:0015979 photosynthesis
Cellular Component
GO:0005576 extracellular region
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8j6z, PDBe:8j6z, PDBj:8j6z
PDBsum8j6z
PubMed37936349
UniProtQ949Q5|PSAO_ARATH Photosystem I subunit O (Gene Name=PSAO)

[Back to BioLiP]