Structure of PDB 8i7j Chain O

Receptor sequence
>8i7jO (length=127) Species: 284590 (Kluyveromyces lactis NRRL Y-1140) [Search protein sequence]
SQVFGVARIFASFNDTFVHVTDLSGRETIARVTGGMKVKADRDESSPYAA
MLAAQDVAAKCKEVGITAVHIKIRATGGTRSKTPGPGGQAALRALARSGL
RIGRIEDVTPVPSDSTRKKGGRRGRRL
3D structure
PDB8i7j Yeast eukaryotic initiation factor 4B remodels the mRNA entry site on the small ribosomal subunit
ChainO
Resolution4.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna O R18 F20 N24 D25 F27 R36 T38 R41 V42 G45 M46 R52 R84 P122 S123 D124 S125 T126 R127 K128 K129 G131 R132 R133 R135 R136 L137 R8 F10 N14 D15 F17 R26 T28 R31 V32 G35 M36 R42 R74 P112 S113 D114 S115 T116 R117 K118 K119 G121 R122 R123 R125 R126 L127
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8i7j, PDBe:8i7j, PDBj:8i7j
PDBsum8i7j
PubMed
UniProtP27069|RS14_KLULA Small ribosomal subunit protein uS11 (Gene Name=RPS14)

[Back to BioLiP]