Structure of PDB 8fr8 Chain O

Receptor sequence

>8fr8O (length=182) Species: 246196 (Mycolicibacterium smegmatis MC2 155)

KALPRLKQRYREEIREALQQEFNYANVMQIPGVVKVVVNMGVGDAARDAK
LINGAINDLALITGQKPEVRRARKSIAQFKLREGMPIGARVTLRGDRMWE
FLDRLISIALPRIRDFRGLSPKQFDGTGNYTFGLNEQSMFHEIDVDSIDR
PRGMDITVVTTATNDAEGRALLRALGFPFKEN

3D structure

• PDB: 8fr8 Starvation sensing by mycobacterial RelA/SpoT homologue through constitutive surveillance of translation.
• Chain: O
• Resolution: 2.76 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	O	S80 I81 A82 K85 L86 R87	S75 I76 A77 K80 L81 R82
BS02	rna	O	R16 N31 V32 M33 Q34 Q70 K71 E73 V74 R76 R95 T97 R99	R11 N26 V27 M28 Q29 Q65 K66 E68 V69 R71 R90 T92 R94
BS03	rna	O	K40 V42 N44 G46 G48 R75 A77 R78 I81 Q83 F84 L86 I92 R95 Q128 F129 D130 N134 T136 F137 L139 G158 M159 D160 T162 V164	K35 V37 N39 G41 G43 R70 A72 R73 I76 Q78 F79 L81 I87 R90 Q123 F124 D125 N129 T131 F132 L134 G153 M154 D155 T157 V159

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8fr8, PDBe:8fr8, PDBj:8fr8
• PDBsum: 8fr8
• PubMed: 37216503
• UniProt: A0QSG1|RL5_MYCS2 Large ribosomal subunit protein uL5 (Gene Name=rplE)