Structure of PDB 8fmw Chain O

Receptor sequence
>8fmwO (length=88) Species: 224326 (Borreliella burgdorferi B31) [Search protein sequence]
MIDKKQKQKIVSEFGKNESDTGSVGVQIALITGRIKYLTEHLKINKKDHS
SKRGLLKLVGQRRSLLRYYQKKDLEAYRMLISKLGLRK
3D structure
PDB8fmw The structure of a hibernating ribosome in a Lyme disease pathogen.
ChainO
Resolution2.86 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna O M1 K7 K16 S19 D20 T21 G22 Q27 R34 Y37 H41 N45 K47 D48 H49 S50 R53 K57 S64 R67 Y68 M1 K7 K16 S19 D20 T21 G22 Q27 R34 Y37 H41 N45 K47 D48 H49 S50 R53 K57 S64 R67 Y68
BS02 rna O T39 R87 T39 R87
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8fmw, PDBe:8fmw, PDBj:8fmw
PDBsum8fmw
PubMed37907464
UniProtO51744|RS15_BORBU Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]