Structure of PDB 8eth Chain O

Receptor sequence

>8ethO (length=185) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence]

EFQKVVVIDAKGHLLGRLASVVAKQLLGGQKVVVVRCEELNISGHFFRNK
LKYLAYLRAFHFRAPSRIFQKAVRGMLPHKTARGQAALEHLQAVEGIPPP
FDKQKRVVVPAALRVLRLKPGRKYCTVGRLSSEVGWKYNDIVAKLEERRK
VKSAAFYQAKLAKQKKIASAKEASPVNQKLSQFGY

3D structure

PDB

8eth Chromatin localization of nucleophosmin organizes ribosome biogenesis.

Chain

Resolution

3.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	O	K6 K13 G18 R19 S22 K26 R38 S45 R50 A71 H73 F74 R75 A84 R86 G87 M88 H91 T93 A94 R95 V106 I109 P111 P112 D114 K115 Q116 R118 R126 V127 L130 K131 P132 R134 K149 Y150 L157 R161 K162 K164 S165 F168 Y169 K172	K4 K11 G16 R17 S20 K24 R36 S43 R48 A59 H61 F62 R63 A72 R74 G75 M76 H79 T81 A82 R83 V94 I97 P99 P100 D102 K103 Q104 R106 R114 V115 L118 K119 P120 R122 K137 Y138 L145 R149 K150 K152 S153 F156 Y157 K160

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0017148	negative regulation of translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8eth, PDBe:8eth, PDBj:8eth
PDBsum	8eth
PubMed	36423630
UniProt	O42991\|RL16B_SCHPO Large ribosomal subunit protein uL13B (Gene Name=rpl1601)

[Back to BioLiP]