Structure of PDB 8d8l Chain O

Receptor sequence

>8d8lO (length=210) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

SAKAVKFLKAQRRKQKNEAKQATLKASTDKVDPVLGRADTPFITRIMAEL
KEPLVLSKGYNIEEVDKFLAAIESAKRERIEKLEDRREAILRILSMRNSE
NKNAIKMAVELARKEFERFPGDTGSSEVQAACMTVRIQNMANHIKEHRKD
FANTRNLRILVQQRQAILRYLKRDNPEKYYWTIQKLGLNDAAITDEFNMD
RRYMQDYEFF

3D structure

PDB

8d8l Principles of mitoribosomal small subunit assembly in eukaryotes.

Chain

Resolution

2.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	O	S34 K36 A37 F40 A43 R46 K47 N50 K53 Q54 L57 N149 K154 R166 F167 T171 G172 S173 Q177 R184 N187 M188 H191 H195 K197 D198 F199 N201 R203 Q210 Q211 Y218 R221 E244 N246 D248 R249	S1 K3 A4 F7 A10 R13 K14 N17 K20 Q21 L24 N101 K106 R118 F119 T123 G124 S125 Q129 R136 N139 M140 H143 H147 K149 D150 F151 N153 R155 Q162 Q163 Y170 R173 E196 N198 D200 R201

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005763	mitochondrial small ribosomal subunit
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8d8l, PDBe:8d8l, PDBj:8d8l
PDBsum	8d8l
PubMed	36482135
UniProt	P21771\|RT28_YEAST Small ribosomal subunit protein uS15m (Gene Name=MRPS28)

[Back to BioLiP]