Structure of PDB 8d8j Chain O

Receptor sequence

>8d8jO (length=210) Species: 4932 (Saccharomyces cerevisiae)

SAKAVKFLKAQRRKQKNEAKQATLKASTDKVDPVLGRADTPFITRIMAEL
KEPLVLSKGYNIEEVDKFLAAIESAKREDIEKLEDRREAILRILSMRNSE
NKNAIKMAVELARKEFERFPGDTGSSEVQAACMTVRIQNMANHIKEHRKD
FANTRNLRILVQQRQAILRYLKRDNPEKYYWTIQKLGLNDAAITDEFNMD
RRYMQDYEFF

3D structure

• PDB: 8d8j Principles of mitoribosomal small subunit assembly in eukaryotes.
• Chain: O
• Resolution: 3.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	O	F40 A43 R46 K47 N50 K53 Q54 N149 K150 K154 R161 D170 T171 G172 S173 Q177 R184 N187 H191 H195 D198 N201 R203 Q210 Q211 Y218 R221 E244 R249	F7 A10 R13 K14 N17 K20 Q21 N101 K102 K106 R113 D122 T123 G124 S125 Q129 R136 N139 H143 H147 D150 N153 R155 Q162 Q163 Y170 R173 E196 R201

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8d8j, PDBe:8d8j, PDBj:8d8j
• PDBsum: 8d8j
• PubMed: 36482135
• UniProt: P21771|RT28_YEAST Small ribosomal subunit protein uS15m (Gene Name=MRPS28)