Structure of PDB 8cee Chain O

Receptor sequence
>8ceeO (length=85) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
TQERKNQLINEFKTHESDTGSPEVQIAILTDSINNLNEHLRTHKKDHHSR
RGLLKMVGKRRNLLTYLRNKDVTRYRELINKLGLR
3D structure
PDB8cee Structural basis of ribosomal 30S subunit degradation by RNase R
ChainO
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna O K8 H18 S20 D21 T22 G23 S24 Q28 N38 L39 H42 H46 D49 H50 H51 S52 R54 G55 L57 K58 K62 N65 Y69 K5 H15 S17 D18 T19 G20 S21 Q25 N35 L36 H39 H43 D46 H47 H48 S49 R51 G52 L54 K55 K59 N62 Y66
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8cee, PDBe:8cee, PDBj:8cee
PDBsum8cee
PubMed38326618
UniProtP21473|RS15_BACSU Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]