Structure of PDB 8bvh Chain O

Receptor sequence
>8bvhO (length=69) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence]
KGHSLQDPYLNTLRKERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQ
MVYKHAISTVVPSRPVRLP
3D structure
PDB8bvh Translational regulation by Hfq-Crc assemblies emerges from polymorphic ribonucleoprotein folding.
ChainO
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna O Y25 G29 I30 K31 L32 Q33 N48 Q52 S60 T61 Y23 G27 I28 K29 L30 Q31 N46 Q50 S58 T59
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006417 regulation of translation
GO:0009372 quorum sensing
GO:0043487 regulation of RNA stability
GO:0043609 regulation of carbon utilization
GO:0045974 regulation of translation, ncRNA-mediated
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8bvh, PDBe:8bvh, PDBj:8bvh
PDBsum8bvh
PubMed36504222
UniProtQ9HUM0|HFQ_PSEAE RNA-binding protein Hfq (Gene Name=hfq)

[Back to BioLiP]