Structure of PDB 8bpx Chain O |
>8bpxO (length=123) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] |
GSKKVSDRIVKLSAIDPDGYKQDIIGLSGQTLLRALTHTGLIDPASHRLD DIEACSAECEVQIAEEWLEKLPPRTYDEEYVLKRSSRSRILNKHSRLGCQ VVLTQELQGMVVAVPEAKPWDIP |
|
PDB | 8bpx Cryo-EM structure of the respiratory I + III 2 supercomplex from Arabidopsis thaliana at 2 angstrom resolution. |
Chain | O |
Resolution | 2.09 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
FE |
O |
H83 C91 C95 C135 |
H47 C55 C59 C99 |
|
|
|
|