Structure of PDB 8azw Chain O

Receptor sequence

>8azwO (length=49) Species: 4097 (Nicotiana tabacum) [Search protein sequence]

AKSKNHTAHNQSYKAHRNGIKKPRKHRHSSTKGMDPKFLRNQRYARKHN

3D structure

PDB

8azw Structure of the actively translating plant 80S ribosome at 2.2 angstrom resolution.

Chain

Resolution

2.14 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	O	A2 K3 K5 N6 H7 T8 A9 H10 N11 Q12 S13 K15 H17 R18 N19 R25 K26 H27 R28 H29 S31 T32 D36 P37 K38 R41 N42 Q43 R44 Y45 A46 R47 H49 N50	A1 K2 K4 N5 H6 T7 A8 H9 N10 Q11 S12 K14 H16 R17 N18 R24 K25 H26 R27 H28 S30 T31 D35 P36 K37 R40 N41 Q42 R43 Y44 A45 R46 H48 N49

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links