Structure of PDB 7zag Chain O

Receptor sequence
>7zagO (length=141) Species: 272844 (Pyrococcus abyssi GE5) [Search protein sequence]
DFRHIVRVAGVDLDGNKQLRWALTAIKGVGINFATMVCRVAGLDPFMKAG
YLTDEQVKKIEEILQDPVAHGIPRWAVNRPKDYETGRDLHLITAKLDMAI
REDIMRLRRIRAYRGIRHELGLPVRGQRTRSNFRRGQTVGV
3D structure
PDB7zag Role of aIF5B in archaeal translation initiation.
ChainO
Resolution2.77 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna O W23 G30 V31 G32 F35 W77 A78 N80 P82 R116 R119 H120 V126 R127 Q129 R130 T131 R132 S133 N134 F135 R136 R137 G138 Q139 V141 W21 G28 V29 G30 F33 W75 A76 N78 P80 R114 R117 H118 V124 R125 Q127 R128 T129 R130 S131 N132 F133 R134 R135 G136 Q137 V139
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zag, PDBe:7zag, PDBj:7zag
PDBsum7zag
PubMed35694843
UniProtQ9V1A0|RS13_PYRAB Small ribosomal subunit protein uS13 (Gene Name=rps13)

[Back to BioLiP]