Structure of PDB 7y8a Chain O

Receptor sequence
>7y8aO (length=92) Species: 173977 (Chroomonas placoidea) [Search protein sequence]
FEISDGVEFDLNPLVLAISFLGWSLPGLLPSNIPLYGGKGLTTALFAEIG
EHLQTFPAPPPIGDPFWVILFIWHSGLFATMIFGTIGYNGYG
3D structure
PDB7y8a Structural basis and evolution of the photosystem I-light-harvesting supercomplex of cryptophyte algae.
ChainO
Resolution2.71 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA O S86 I88 S31 I33
BS02 CLA O F64 M136 I141 N144 F9 M81 I86 N89
BS03 CLA O F111 P112 P114 W122 F56 P57 P59 W67
BS04 CLA O I104 L125 F126 W128 H129 L132 F133 I49 L70 F71 W73 H74 L77 F78
BS05 CLA O F138 G139 Y146 F83 G84 Y91
BS06 II0 O I73 W78 P81 G82 Y91 I18 W23 P26 G27 Y36
BS07 II0 O L66 N67 H107 F121 T140 L11 N12 H52 F66 T85
External links