Structure of PDB 7uvv Chain O

Receptor sequence
>7uvvO (length=117) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence]
SGKHPLVQAIENSQLKTDLPEFAPGDTVVVQVKVKEGDRERLQAFEGVVI
AKKNRGLNSAFTVRKISSGVGVERVFQTHSPVVAKIEVKRRGDVRRAKLY
YLRDLSGKAARIREKLP
3D structure
PDB7uvv Streptothricin F is a bactericidal antibiotic effective against highly drug-resistant gram-negative bacteria that interacts with the 30S subunit of the 70S ribosome.
ChainO
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna O S2 G3 K4 K54 N55 R56 N59 R96 R97 A98 K99 Y101 S1 G2 K3 K53 N54 R55 N58 R95 R96 A97 K98 Y100
BS02 rna O R42 R112 R41 R111
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7uvv, PDBe:7uvv, PDBj:7uvv
PDBsum7uvv
PubMed37192172
UniProtB7IAS9|RL19_ACIB5 Large ribosomal subunit protein bL19 (Gene Name=rplS)

[Back to BioLiP]