Structure of PDB 7s0s Chain O

Receptor sequence

>7s0sO (length=136) Species: 1772 (Mycolicibacterium smegmatis)

MLIPRKVKHRKQHHPEQRGIASGGTSVSFGDYGIQALEHAYITNRQIESA
RIAINRHIKRGGKVWINIFPDRPLTKKPAETRMGSGKGSPEWWVANVKPG
RVLFELSYPDEKTARDALTRAIHKLPIKARIVTREE

3D structure

• PDB: 7s0s 50S subunit recognition and modification by the Mycobacterium tuberculosis ribosomal RNA methyltransferase TlyA.
• Chain: O
• Resolution: 3.05 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	O	P4 R5 K6 H9 K11 Q12 H13 H14 E16 Q17 R18 S22 G24 R45 Q46 S49 R60 K63 W65 F69 K76 K77 E80 R82 M83 G84 G86 K87 R101 R120 H123 K124 P126 K128	P4 R5 K6 H9 K11 Q12 H13 H14 E16 Q17 R18 S22 G24 R45 Q46 S49 R60 K63 W65 F69 K76 K77 E80 R82 M83 G84 G86 K87 R101 R120 H123 K124 P126 K128
BS02	MG	O	S22 G23 G24 T25	S22 G23 G24 T25

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7s0s, PDBe:7s0s, PDBj:7s0s
• PDBsum: 7s0s
• PubMed: 35357969
• UniProt: A0QSD8|RL16_MYCS2 Large ribosomal subunit protein uL16 (Gene Name=rplP)