Structure of PDB 7rh7 Chain O

Receptor sequence

>7rh7O (length=223) Species: 246196 (Mycolicibacterium smegmatis MC2 155)

QSALLRTGKQLFETSCVSCHGANLQGVPDRGPSLIGTGEAAVYFQVSTGR
MPAMRGEAQAPSKPPHFDESQIDALGAYVQANGGGPTVPRDDHGAVAQES
LIGGDVARGGDLFRLNCASCHNFTGKGGALSSGKYAPDLGDANPAQIYTA
MLTGPQNMPKFSDRQLTPDEKRDIVAYVRESAETPSYGGYGLGGFGPAPE
GMAMWIIGMVAAIGVAMWIGSRA

3D structure

• PDB: 7rh7 Structure of mycobacterial CIII 2 CIV 2 respiratory supercomplex bound to the tuberculosis drug candidate telacebec (Q203).
• Chain: O
• Resolution: 3.0 Å

Enzymatic activity

• Enzyme Commision number: 7.1.1.8: quinol--cytochrome-c reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MQ9	O	Y261 P270 M273	Y190 P199 M202
BS02	HEC	O	C87 C90 H91 P103 L105 T108 A112 V113 V117 M122 A124 F138 Q227	C16 C19 H20 P32 L34 T37 A41 V42 V46 M51 A53 F67 Q156
BS03	HEC	O	F115 R121 Q130 N187 C188 C191 H192 L201 P208 L210 I218 A221 M222 P226 Q227 M229 P230 F232	F44 R50 Q59 N116 C117 C120 H121 L130 P137 L139 I147 A150 M151 P155 Q156 M158 P159 F161
BS04	9YF	O	D209 G211 A253 Y261 G262 M273 I277	D138 G140 A182 Y190 G191 M202 I206
BS05	MQ9	O	M273 W276	M202 W205

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0020037 heme binding

External links

• PDB: RCSB:7rh7, PDBe:7rh7, PDBj:7rh7
• PDBsum: 7rh7
• PubMed: 34590581
• UniProt: I7FPH1