Structure of PDB 7rh5 Chain O

Receptor sequence

>7rh5O (length=223) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]

QSALLRTGKQLFETSCVSCHGANLQGVPDRGPSLIGTGEAAVYFQVSTGR
MPAMRGEAQAPSKPPHFDESQIDALGAYVQANGGGPTVPRDDHGAVAQES
LIGGDVARGGDLFRLNCASCHNFTGKGGALSSGKYAPDLGDANPAQIYTA
MLTGPQNMPKFSDRQLTPDEKRDIVAYVRESAETPSYGGYGLGGFGPAPE
GMAMWIIGMVAAIGVAMWIGSRA

3D structure

PDB

7rh5 Structure of mycobacterial CIII 2 CIV 2 respiratory supercomplex bound to the tuberculosis drug candidate telacebec (Q203).

Chain

Resolution

3.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

7.1.1.8: quinol--cytochrome-c reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	MQ9	O	Y261 L263 G264 P270 M273	Y190 L192 G193 P199 M202
BS02	MQ9	O	M273 W276 I277	M202 W205 I206
BS03	HEC	O	S86 C87 C90 H91 P103 L105 T108 A112 V113 M122 A124 F138 Q227	S15 C16 C19 H20 P32 L34 T37 A41 V42 M51 A53 F67 Q156
BS04	HEC	O	F115 R121 N187 C188 C191 H192 P208 L210 I218 M222 P226 Q227 M229 P230 F232	F44 R50 N116 C117 C120 H121 P137 L139 I147 M151 P155 Q156 M158 P159 F161
BS05	9YF	O	D209 G211 A253 S257 G260 Y261 M273 I278	D138 G140 A182 S186 G189 Y190 M202 I207

Gene Ontology

	Molecular Function
GO:0009055	electron transfer activity
GO:0020037	heme binding

View graph for
Molecular Function

External links

PDB	RCSB:7rh5, PDBe:7rh5, PDBj:7rh5
PDBsum	7rh5
PubMed	34590581
UniProt	I7FPH1

[Back to BioLiP]