Structure of PDB 7qv1 Chain O

Receptor sequence

>7qv1O (length=120) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

MITKTSKNAARLKRHARVRAKLSGTAERPRLNVFRSNKHIYAQIIDDVNG
VTLASASTLDKDLNVESTGDTSAATKVGELVAKRAAEKGISDVVFDRGGY
LYHGRVKALADAAREAGLKF

3D structure

• PDB: 7qv1 Bacterial ribosome collision sensing by a MutS DNA repair ATPase paralogue.
• Chain: O
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	O	K4 K7 R11 H15 R19 R30 F34 R35 S36 N37 K38 H39 Y41 Q43 G50 V51 T52 S55 L59 S67 D70 Y100 H103 R105	K4 K7 R11 H15 R19 R30 F34 R35 S36 N37 K38 H39 Y41 Q43 G50 V51 T52 S55 L59 S67 D70 Y100 H103 R105
BS02	rna	O	I2 T3 R14 R17 L22 R97 Y102 R114 F120	I2 T3 R14 R17 L22 R97 Y102 R114 F120

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006364 rRNA processing
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7qv1, PDBe:7qv1, PDBj:7qv1
• PDBsum: 7qv1
• PubMed: 35264791
• UniProt: P46899|RL18_BACSU Large ribosomal subunit protein uL18 (Gene Name=rplR)