Structure of PDB 7qh4 Chain O

Receptor sequence

>7qh4O (length=120) Species: 1423 (Bacillus subtilis) [Search protein sequence]

MITKTSKNAARLKRHARVRAKLSGTAERPRLNVFRSNKHIYAQIIDDVNG
VTLASASTLDKDLNVESTGDTSAATKVGELVAKRAAEKGISDVVFDRGGY
LYHGRVKALADAAREAGLKF

3D structure

PDB

7qh4 Ribosome collisions induce mRNA cleavage and ribosome rescue in bacteria.

Chain

Resolution

5.45 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	O	M1 I2 R14 R17 K21 F95 R97 G99 Y102 R114 F120	M1 I2 R14 R17 K21 F95 R97 G99 Y102 R114 F120
BS02	rna	O	K4 S6 K7 R11 R19 F34 R35 S36 N37 K38 H39 Y41 Q43 T52 S55 T71 Y100 L101 H103 G104 R105	K4 S6 K7 R11 R19 F34 R35 S36 N37 K38 H39 Y41 Q43 T52 S55 T71 Y100 L101 H103 G104 R105

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0008097	5S rRNA binding
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links