Structure of PDB 7par Chain O

Receptor sequence
>7parO (length=80) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]
RMGRVHYPTYRIVAVDSRVKRDGKYIALIGHLNPALKENKCKIDEAVALE
WLNKGAKPTDTVRSLFSQTGLWKKFVESKK
3D structure
PDB7par Visualizing translation dynamics at atomic detail inside a bacterial cell.
ChainO
Resolution8.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna O R2 M3 G4 R5 V6 H7 Y8 R12 S18 R19 K21 R22 D23 G24 K25 H32 P35 A36 K38 E39 N40 K43 N54 K55 K58 T60 D61 T62 S65 K74 R1 M2 G3 R4 V5 H6 Y7 R11 S17 R18 K20 R21 D22 G23 K24 H31 P34 A35 K37 E38 N39 K42 N53 K54 K57 T59 D60 T61 S64 K73
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7par, PDBe:7par, PDBj:7par
PDBsum7par
PubMed36171285
UniProtP75131|RS16_MYCPN Small ribosomal subunit protein bS16 (Gene Name=rpsP)

[Back to BioLiP]