Structure of PDB 7nvz Chain O

Receptor sequence
>7nvzO (length=179) Species: 9606 (Homo sapiens) [Search protein sequence]
SGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPR
TTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNM
VGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSG
KVVLTGAKVRAEIYEAFENIYPILKGFRK
3D structure
PDB7nvz Structures of mammalian RNA polymerase II pre-initiation complexes.
ChainO
Resolution7.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000979 RNA polymerase II core promoter sequence-specific DNA binding
GO:0000995 RNA polymerase III general transcription initiation factor activity
GO:0001046 core promoter sequence-specific DNA binding
GO:0001091 RNA polymerase II general transcription initiation factor binding
GO:0001093 TFIIB-class transcription factor binding
GO:0001164 RNA polymerase I core promoter sequence-specific DNA binding
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0016251 RNA polymerase II general transcription initiation factor activity
GO:0017162 aryl hydrocarbon receptor binding
GO:0019899 enzyme binding
GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding
GO:0140297 DNA-binding transcription factor binding
Biological Process
GO:0001188 RNA polymerase I preinitiation complex assembly
GO:0006352 DNA-templated transcription initiation
GO:0006366 transcription by RNA polymerase II
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0006383 transcription by RNA polymerase III
GO:0007283 spermatogenesis
GO:0042789 mRNA transcription by RNA polymerase II
GO:0045893 positive regulation of DNA-templated transcription
GO:0051123 RNA polymerase II preinitiation complex assembly
GO:0060261 positive regulation of transcription initiation by RNA polymerase II
Cellular Component
GO:0000785 chromatin
GO:0000791 euchromatin
GO:0001673 male germ cell nucleus
GO:0001674 female germ cell nucleus
GO:0001939 female pronucleus
GO:0001940 male pronucleus
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005668 RNA polymerase transcription factor SL1 complex
GO:0005669 transcription factor TFIID complex
GO:0005672 transcription factor TFIIA complex
GO:0005737 cytoplasm
GO:0032991 protein-containing complex
GO:0045120 pronucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7nvz, PDBe:7nvz, PDBj:7nvz
PDBsum7nvz
PubMed33902107
UniProtP20226|TBP_HUMAN TATA-box-binding protein (Gene Name=TBP)

[Back to BioLiP]