Structure of PDB 7ml4 Chain O

Receptor sequence

>7ml4O (length=180) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

SGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPK
TTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNI
VGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSG
KIVLTGAKQREEIYQAFEAIYPVLSEFRKM

3D structure

PDB

7ml4 Structural visualization of de novo transcription initiation by Saccharomyces cerevisiae RNA polymerase II.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	O	F99 A100 F116 Q158 N159 V161 L189 F190 I194 R196 V203 L205 T215 G216	F39 A40 F56 Q98 N99 V101 L129 F130 I134 R136 V143 L145 T155 G156
BS02	dna	O	Q68 N69 V71 R98 F99 R105 L114 T124 G125 K127 V161 S163 P191 F207 K211	Q8 N9 V11 R38 F39 R45 L54 T64 G65 K67 V101 S103 P131 F147 K151

Gene Ontology

	Molecular Function
GO:0000979	RNA polymerase II core promoter sequence-specific DNA binding
GO:0001016	RNA polymerase III transcription regulatory region sequence-specific DNA binding
GO:0001092	TFIIA-class transcription factor complex binding
GO:0001179	RNA polymerase I general transcription initiation factor binding
GO:0003677	DNA binding
GO:0003682	chromatin binding
GO:0005515	protein binding
GO:0008301	DNA binding, bending
GO:0016251	RNA polymerase II general transcription initiation factor activity
GO:0061629	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0097718	disordered domain specific binding
GO:0140297	DNA-binding transcription factor binding

	Biological Process
GO:0001188	RNA polymerase I preinitiation complex assembly
GO:0006352	DNA-templated transcription initiation
GO:0006359	regulation of transcription by RNA polymerase III
GO:0042790	nucleolar large rRNA transcription by RNA polymerase I
GO:0045892	negative regulation of DNA-templated transcription
GO:0045944	positive regulation of transcription by RNA polymerase II
GO:0051123	RNA polymerase II preinitiation complex assembly
GO:0070898	RNA polymerase III preinitiation complex assembly

	Cellular Component
GO:0000126	transcription factor TFIIIB complex
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005667	transcription regulator complex
GO:0005669	transcription factor TFIID complex
GO:0005672	transcription factor TFIIA complex
GO:0032991	protein-containing complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7ml4, PDBe:7ml4, PDBj:7ml4
PDBsum	7ml4
PubMed	35051353
UniProt	P13393\|TBP_YEAST TATA-box-binding protein (Gene Name=SPT15)

[Back to BioLiP]