Structure of PDB 7ksq Chain O

Receptor sequence
>7ksqO (length=88) Species: 3218 (Physcomitrium patens) [Search protein sequence]
NRDWLRRDLSVIGFGLIGWLAPSSLPVINGNSLTGLFLGSIGPELAHFPT
GPALTSPFWLWMVTWHVGLFIVLTFGQIGFKGRQDGYW
3D structure
PDB7ksq The structure of the Physcomitrium patens photosystem I reveals a unique Lhca2 paralogue replacing Lhca4.
ChainO
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA O N84 W116 N29 W61
BS02 CLA O T129 Q132 I133 K136 T74 Q77 I78 K81
BS03 CLA O W120 H121 L124 W65 H66 L69
BS04 CLA O F130 G131 G134 F75 G76 G79
External links