Structure of PDB 7f0d Chain O

Receptor sequence
>7f0dO (length=116) Species: 419947 (Mycobacterium tuberculosis H37Ra) [Search protein sequence]
ATRRISRLRRHTRLRKKLSGTAERPRLVVHRSARHIHVQLVNDLNGTTVA
AASSIEADVRGVPGDKKARSVRVGQLIAERAKAAGIDTVVFDRGGYTYGG
RIAALADAARENGLSF
3D structure
PDB7f0d Cryo-EM structure of Mycobacterium tuberculosis 50S ribosomal subunit bound with clarithromycin reveals dynamic and specific interactions with macrolides.
ChainO
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna O R15 R16 R19 K22 K23 L24 R30 R99 Y104 F122 R9 R10 R13 K16 K17 L18 R24 R93 Y98 F116
BS02 rna O A7 R9 R13 H17 R21 H36 R37 S38 R40 Q45 V47 T54 I61 D71 K72 K73 G106 R107 A1 R3 R7 H11 R15 H30 R31 S32 R34 Q39 V41 T48 I55 D65 K66 K67 G100 R101
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7f0d, PDBe:7f0d, PDBj:7f0d
PDBsum7f0d
PubMed34935599
UniProtA5U0A6|RL18_MYCTA Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]