Structure of PDB 7dz8 Chain O

Receptor sequence
>7dz8O (length=97) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]
EASNKSFPRDWVKTDPLVPVLGFAGWTIPANIGVSAFGGQSLFGLFTQSI
GENLAHFPTGPALDDKFWLYLITYHLGLFLTITLGQIGVQGRKQGYW
3D structure
PDB7dz8 Structural basis of LhcbM5-mediated state transitions in green algae.
ChainO
Resolution3.16 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA O I116 W126 I87 W97
BS02 CLA O A65 F66 A36 F37
BS03 CLA O T112 Q115 I116 Y125 T83 Q86 I87 Y96
BS04 CLA O F75 I79 L100 Y103 H104 L107 F108 F46 I50 L71 Y74 H75 L78 F79
BS05 CLA O T110 L113 G114 G117 V118 W126 T81 L84 G85 G88 V89 W97
BS06 CLA O P87 G89 P90 W97 P58 G60 P61 W68
BS07 CLA O P45 L46 P16 L17
External links