Structure of PDB 7blz Chain O

Receptor sequence
>7blzO (length=97) Species: 280699 (Cyanidioschyzon merolae strain 10D) [Search protein sequence]
FEVSDGEPYPLNPAVIFIALIGWSAVAAIPSNIPVLGGTGLTQAFLASIQ
RLLAQYPTGPKLDDPFWFYLIVYHVGLFALLIFGQIGYAGYAKGTYN
3D structure
PDB7blz Red alga C.merolae Photosystem I
ChainO
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA O F114 I117 N128 F83 I86 N97
BS02 CLA O S62 L67 F99 S31 L36 F68
BS03 CLA O Y40 I113 I117 N128 Y9 I82 I86 N97
BS04 CLA O Y87 F97 Y56 F66
BS05 CLA O L101 H105 V106 L108 F109 L70 H74 V75 L77 F78
BS06 CLA O A50 W54 A110 L111 F114 G115 G118 Y122 A19 W23 A79 L80 F83 G84 G87 Y91
External links