Structure of PDB 7a0s Chain O

Receptor sequence
>7a0sO (length=98) Species: 243230 (Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539) [Search protein sequence]
MFAIIQTGGKQYRVSEGDVIRVESLQGEAGDKVELKALFVGGEQTVFGED
AGKYTVQAEVVEHGRGKKIYIRKYKSGVQYRRRTGHRQNFTAIKILGI
3D structure
PDB7a0s Ribosome-binding and anti-microbial studies of the mycinamicins, 16-membered macrolide antibiotics from Micromonospora griseorubida.
ChainO
Resolution3.22 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna O Q6 T7 V22 R65 K67 K68 I71 Y74 K75 G77 V78 Q79 Y80 R82 R83 T84 G85 H86 Q88 Q6 T7 V22 R65 K67 K68 I71 Y74 K75 G77 V78 Q79 Y80 R82 R83 T84 G85 H86 Q88
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7a0s, PDBe:7a0s, PDBj:7a0s
PDBsum7a0s
PubMed34417608
UniProtQ9RY64|RL21_DEIRA Large ribosomal subunit protein bL21 (Gene Name=rplU)

[Back to BioLiP]