Structure of PDB 6zzx Chain O

Receptor sequence
>6zzxO (length=87) Species: 2649997 (Chlorella ohadii) [Search protein sequence]
WGAYEEPLSLVAGFLGWFAPSNIKVPAFGNESLFGAFHASMLENLANFPQ
GPALTDKFWILMITWHLGLFLALTLGNIGQAARKQGY
3D structure
PDB6zzx Cryo-EM photosystem I structure reveals adaptation mechanisms to extreme high light in Chlorella ohadii.
ChainO
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA O P53 I124 A127 Y133 P7 I78 A81 Y87
BS02 CLA O F83 M87 N93 W111 H112 L115 F37 M41 N47 W65 H66 L69
BS03 CLA O L61 L117 G122 K130 Q131 L15 L71 G76 K84 Q85
BS04 CLA O N93 F94 Q96 P98 N47 F48 Q50 P52
External links