Structure of PDB 6w6k Chain O

Receptor sequence
>6w6kO (length=86) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
LSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHS
RRGLLRMVSQRRKLLDYLKRKDVARYTRLIERLGLR
3D structure
PDB6w6k Alternative conformations and motions adopted by 30S ribosomal subunits visualized by cryo-electron microscopy.
ChainO
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna O L2 S3 T4 T7 D20 G22 Q27 H37 H41 H45 K47 S51 R53 R57 K64 Y68 R71 K72 L1 S2 T3 T6 D19 G21 Q26 H36 H40 H44 K46 S50 R52 R56 K63 Y67 R70 K71
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006417 regulation of translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6w6k, PDBe:6w6k, PDBj:6w6k
PDBsum6w6k
PubMed32989043
UniProtP0ADZ4|RS15_ECOLI Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]