Structure of PDB 6usj Chain O

Receptor sequence
>6usjO (length=99) Species: 9606 (Homo sapiens) [Search protein sequence]
KKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQ
SSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
3D structure
PDB6usj Bridging of nucleosome-proximal DNA double-strand breaks by PARP2 enhances its interaction with HPF1.
ChainO
Resolution10.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna O R40 Y41 R42 G44 T45 V46 A47 K56 R63 K64 L65 R69 R83 R5 Y6 R7 G9 T10 V11 A12 K21 R28 K29 L30 R34 R48
BS02 dna O K37 H39 Y41 R42 T45 R63 R72 R83 F84 R116 V117 T118 M120 K122 K2 H4 Y6 R7 T10 R28 R37 R48 F49 R81 V82 T83 M85 K87
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0045296 cadherin binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0010467 gene expression
GO:0032200 telomere organization
GO:0040029 epigenetic regulation of gene expression
Cellular Component
GO:0000786 nucleosome
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0016020 membrane
GO:0032991 protein-containing complex
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6usj, PDBe:6usj, PDBj:6usj
PDBsum6usj
PubMed33141820
UniProtP68431|H31_HUMAN Histone H3.1 (Gene Name=H3C1)

[Back to BioLiP]