Structure of PDB 6swe Chain O

Receptor sequence

>6sweO (length=143) Species: 272844 (Pyrococcus abyssi GE5)

DFRHIVRVAGVDLDGNKQLRWALTAIKGVGINFATMVCRVAGLDPFMKAG
YLTDEQVKKIEEILQDPVAHGIPRWAVNRPKDYETGRDLHLITAKLDMAI
REDIMRLRRIRAYRGIRHELGLPVRGQRTRSNFRRGQTVGVSR

3D structure

• PDB: 6swe Cryo-EM study of an archaeal 30S initiation complex gives insights into evolution of translation initiation.
• Chain: O
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	O	Q20 W23 G30 V31 G32 N34 F35 W77 N80 P82 Y115 R119 H120 V126 R127 Q129 R130 T131 R132 S133 N134 F135 R136 G138 T140	Q18 W21 G28 V29 G30 N32 F33 W75 N78 P80 Y113 R117 H118 V124 R125 Q127 R128 T129 R130 S131 N132 F133 R134 G136 T138
BS02	rna	O	G142 S144 R145	G140 S142 R143

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6swe, PDBe:6swe, PDBj:6swe
• PDBsum: 6swe
• PubMed: 32029867
• UniProt: Q9V1A0|RS13_PYRAB Small ribosomal subunit protein uS13 (Gene Name=rps13)