Structure of PDB 6swa Chain O

Receptor sequence

>6swaO (length=153) Species: 10090 (Mus musculus) [Search protein sequence]

VRYSLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKATKYLKDV
TLKKQCVPFRRYNGGVGRCAQAKQWGWTQGRWPKKSAEFLLHMLKNAESN
AELKGLDVDSLVIEHIQVNKAPKMRRRTYRAHGRINPYMSSPCHIEMILT
EKE

3D structure

PDB

6swa Protein Synthesis in the Developing Neocortex at Near-Atomic Resolution Reveals Ebp1-Mediated Neuronal Proteostasis at the 60S Tunnel Exit.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	O	R3 Y4 K16 R18 S20 R23 H25 F26 K27 R30 K37 K54 K55 R62 Y63 G65 G66 G68 R69 A71 Q72 K74 Q75 Q80 R82 W83 P84 K85 K86 H93 N97 S100 N101 H116 Q118 V119 R127 R128 T129 Y130 R131 A132 H133 G134 R135 I136 N137 P138 Y139 M140 S141	R2 Y3 K15 R17 S19 R22 H24 F25 K26 R29 K36 K53 K54 R61 Y62 G64 G65 G67 R68 A70 Q71 K73 Q74 Q79 R81 W82 P83 K84 K85 H92 N96 S99 N100 H115 Q117 V118 R126 R127 T128 Y129 R130 A131 H132 G133 R134 I135 N136 P137 Y138 M139 S140
BS02	rna	O	R3 S5 R61 R62 W78 N120 K121	R2 S4 R60 R61 W77 N119 K120

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6swa, PDBe:6swa, PDBj:6swa
PDBsum	6swa
PubMed	33357414
UniProt	Q9CPR4\|RL17_MOUSE Large ribosomal subunit protein uL22 (Gene Name=Rpl17)

[Back to BioLiP]