Structure of PDB 6spf Chain O

Receptor sequence

>6spfO (length=115) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence]

SVKKETRLRRARKARLKMRELETVRLCVYRSSQHIYAQVIAADGGKVLAS
ASTLDKDLREGATGNIDAAKKVGQLVAERAKAAGVTQVAFDRSGFKYHGR
VKALADAAREGGLEF

3D structure

PDB

6spf Structure ofPseudomonas aeruginosaribosomes from an aminoglycoside-resistant clinical isolate.

Chain

Resolution

2.89 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	O	R10 R11 R13 K14 L17 K18 M19 E21 L22 T24 F91 R93 Y98 R110 F116	R9 R10 R12 K13 L16 K17 M18 E20 L21 T23 F90 R92 Y97 R109 F115
BS02	rna	O	K4 R20 R26 C28 Y30 R31 S33 Q34 H35 V48 S51 L55 K57 R60 N66 I67 K97 H99 G100 R101	K3 R19 R25 C27 Y29 R30 S32 Q33 H34 V47 S50 L54 K56 R59 N65 I66 K96 H98 G99 R100

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0008097	5S rRNA binding
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links