Structure of PDB 6sl5 Chain O

Receptor sequence
>6sl5O (length=86) Species: 3046 (Dunaliella salina) [Search protein sequence]
LRVDPIVPAISFVGWTLPSNIGTSALNGQSLFGAFYESIGQNLAHWPTGF
ALDDKFWLYMVTWHTGLFIVMLLGQVGFKGRTEDYF
3D structure
PDB6sl5 Structure and energy transfer pathways of the Dunaliella Salina photosystem I supercomplex.
ChainO
Resolution2.84 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA O F109 L113 Q116 V117 K120 F68 L72 Q75 V76 K79
BS02 CLA O F73 F76 Y77 I80 M101 W104 H105 L108 F109 F32 F35 Y36 I39 M60 W63 H64 L67 F68
BS03 CLA O N83 L84 G90 W98 N42 L43 G49 W57
External links