Structure of PDB 6s05 Chain O

Receptor sequence

>6s05O (length=203) Species: 4932 (Saccharomyces cerevisiae)

GAYKYLEELQRKKQSDVLRFLQRVRVWEYRQKNVIHRAARPTRPDKARRL
GYKAKQGFVIYRVRVRRGNRKRPVPKGATYGKPTNQGVNELKYQRSLRAT
AEERVGRRAANLRVLNSYWVNQDSTYKYFEVILVDPQHKAIRRDARYNWI
CDPVHKHREARGLTATGKKSRGINKGHKFNNTKAGRRKTWKRQNTLSLWR
YRK

3D structure

• PDB: 6s05 Mechanism of completion of peptidyltransferase centre assembly in eukaryotes.
• Chain: O
• Resolution: 3.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	O	Y4 R12 K14 Q15 R24 W28 R31 V35 R41 R44 K47 R49 R50 A55 Q57 R67 R68 G69 N70 R71 K72 R73 P76 K77 Y81 K83 P84 T85 N86 Q87 N90 E91 K93 Y94 Q95 R96 S97 E104 R108 S125 T126 Y127 Q138 R144 R147 W150 V155 H156 K157 R162 A166 K169 K170 R172 I174 K176 G177 H178 K179 F180 N181 N182 R187 R188 K189 W191 K192 R193 Q194 W200 R201 Y202 R203 K204	Y3 R11 K13 Q14 R23 W27 R30 V34 R40 R43 K46 R48 R49 A54 Q56 R66 R67 G68 N69 R70 K71 R72 P75 K76 Y80 K82 P83 T84 N85 Q86 N89 E90 K92 Y93 Q94 R95 S96 E103 R107 S124 T125 Y126 Q137 R143 R146 W149 V154 H155 K156 R161 A165 K168 K169 R171 I173 K175 G176 H177 K178 F179 N180 N181 R186 R187 K188 W190 K191 R192 Q193 W199 R200 Y201 R202 K203
BS02	rna	O	R38 Q57 V60 Y62 R109 N112 D136 H139	R37 Q56 V59 Y61 R108 N111 D135 H138

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0022626 cytosolic ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6s05, PDBe:6s05, PDBj:6s05
• PDBsum: 6s05
• PubMed: 31115337
• UniProt: P05748|RL15A_YEAST Large ribosomal subunit protein eL15A (Gene Name=RPL15A)