Structure of PDB 6psd Chain O

Receptor sequence

>6psdO (length=72) Species: 9606 (Homo sapiens)

GQLVMLRKAQEFFQTCDAEGKGFIARKDMQRLHKELPLSLEELEDVFDAL
DADGNGYLTPQEFTTGFSHFFF

3D structure

• PDB: 6psd A tunable LIC1-adaptor interaction modulates dynein activity in a cargo-specific manner.
• Chain: O
• Resolution: 2.66 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	O	F58 L89 V92 A95 L96 F113 F116	F12 L43 V46 A49 L50 F67 F70
BS02	CA	O	D97 D99 N101 Y103 E108	D51 D53 N55 Y57 E62

Gene Ontology

Molecular Function

• GO:0005509 calcium ion binding

External links

• PDB: RCSB:6psd, PDBe:6psd, PDBj:6psd
• PDBsum: 6psd
• PubMed: 33173051
• UniProt: Q9BSW2|EFC4B_HUMAN EF-hand calcium-binding domain-containing protein 4B (Gene Name=CRACR2A)