Structure of PDB 6ppk Chain O

Receptor sequence
>6ppkO (length=100) Species: 1423 (Bacillus subtilis) [Search protein sequence]
KNAARLKRHARVRAKRPRLNVFRSNKHIYAQIIVTLASASTLDKDLNVES
TGDTSAATKVGELVAKRAAEKDVVFDRGGYLYHGRVKALADAAREAGLKF
3D structure
PDB6ppk Structural consequences of the interaction of RbgA with a 50S ribosomal subunit assembly intermediate.
ChainO
Resolution4.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna O R14 R17 K21 R97 Y102 R114 R8 R11 K15 R77 Y82 R94
BS02 rna O K7 L12 H15 R19 R35 S36 N37 K38 H39 T52 L59 D70 Y100 H103 K1 L6 H9 R13 R23 S24 N25 K26 H27 T35 L42 D53 Y80 H83
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006364 rRNA processing
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ppk, PDBe:6ppk, PDBj:6ppk
PDBsum6ppk
PubMed31665744
UniProtP46899|RL18_BACSU Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]